You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb246902 |
---|---|
Category | Proteins |
Description | Recombinant Homo sapiens C-X-C motif chemokine 10 |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 10.6 kDa |
UniProt ID | P02778 |
Protein Sequence | VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP |
Protein Length | Full Length of Mature Protein |
Source | Yeast |
Biological Origin | Homo sapiens (Human) |
Expression Region | 22-98aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | CXCL10 Read more... |
Note | For research use only |
Application notes | This is His-tag protein |
Expiration Date | 6 months from date of receipt. |
> 97 % by SDS-PAGE and HPLC analyses. | |
Approximately 8.6 kDa, a single non-glycosylated polypeptide chain containing 77 amino acids. | |
Escherichia coli |
Unconjugated | |
10.5 kDa | |
Human CXCL10, His Tag (orb1496156) is expressed from human 293 cells (HEK293). It contains AA Val 22 - Pro 98 (Accession # P02778-1). |
Human | |
31.2 pg/ml - 2,000 pg/ml |
Filter by Rating