You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb244148 |
---|---|
Category | Proteins |
Description | Recombinant human Fractalkine |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 24.6 kDa |
UniProt ID | P78423 |
Protein Sequence | QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG |
Protein Length | Partial |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Expression Region | 25-100aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | CX3CL1 Read more... |
Note | For research use only |
Application notes | Chemokine domain of His-SUMO-tag and expression region is 25-100aa |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
95% | |
35.5 kDa | |
Human CX3CL1, His Tag (orb348817) is expressed from human 293 cells (HEK293). It contains AA Gln 25 - Gln 341 (Accession # AAH01163). |
Unconjugated | |
90% | |
36.5 kDa | |
Cynomolgus CX3CL1 Protein, His Tag (orb1496211) is expressed from human 293 cells (HEK293). It contains AA Gly 24 - Ala 352 (Accession # A0A872TN34-1). |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | |
Human cells |
HPLC, SDS-PAGE | |
Unconjugated | |
> 97% pure by SDS-PAGE and HPLC analyses. | |
8.5 kDa |
HPLC, SDS-PAGE | |
Unconjugated | |
> 95% by SDS-PAGE and HPLC analyses | |
8.8 kDa |
Filter by Rating