You have no items in your shopping cart.
Page Not Found
Cart summary
Human CSF2RA protein
Catalog Number: orb594713
| Catalog Number | orb594713 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Granulocyte-macrophage colony-stimulating factor receptor subunit alpha(CSF2RA),partial (Active) |
| Tag | C-terminal 6xHis-tagged |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 35.5 kDa |
| UniProt ID | P15509 |
| Protein Sequence | EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG |
| Protein Length | Partial |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined by its ability to inhibit GM-CSF-dependent proliferation of TF‑1 human erythroleukemic cells is 0.5-2 μg/ml. |
| Expression Region | 23-320aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Alternative names | Granulocyte-Macrophage Colony-Stimulating Factor R Read more... |
| Note | For research use only |
| Application notes | Partial |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Human GM-CSF R alpha Protein, Fc Tag [orb545735]
Unconjugated
95%
60.9 kDa
Human GM-CSF R alpha, Fc Tag (orb545735) is expressed from human 293 cells (HEK293). It contains AA Glu 23 - Gly 320 (Accession # P15509-1).
100 μg, 1 mg - Item 1 of 1
Human GM-CSF R alpha Protein, His Tag [orb545734]
Unconjugated
95%
36.4 kDa
Human GM-CSF R alpha, His Tag (orb545734) is expressed from human 293 cells (HEK293). It contains AA Glu 23 - Gly 320 (Accession # P15509-1).
1 mg, 100 μg - Item 1 of 2
CSF2RA purified MaxPab mouse polyclonal antibody (B01P) [orb2294050]
FC, WB
Human
Mouse
Polyclonal
Unconjugated
50 μg - Item 1 of 1
- Item 1 of 2
Recombinant human GM-CSF R Alpha protein, C-His-Avi (HEK293), Biotin conjugated [orb2328762]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 68-75 kDa based on Tris-Bis PAGE result.
20 μg
