You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb244135 |
---|---|
Category | Proteins |
Description | Recombinant human Granulocyte-macrophage colony-stimulating factor receptor subunit alpha |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 50.5 kDa |
UniProt ID | P15509 |
Protein Sequence | EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG |
Protein Length | Extracellular Domain |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Expression Region | 23-320aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | CSF2RA Read more... |
Note | For research use only |
Application notes | Full length of Extracellular of His-SUMO-tag and expression region is 23-320aa |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
95% | |
60.9 kDa | |
Human GM-CSF R alpha, Fc Tag (orb545735) is expressed from human 293 cells (HEK293). It contains AA Glu 23 - Gly 320 (Accession # P15509-1). |
Unconjugated | |
95% | |
36.4 kDa | |
Human GM-CSF R alpha, His Tag (orb545734) is expressed from human 293 cells (HEK293). It contains AA Glu 23 - Gly 320 (Accession # P15509-1). |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
Greater than 95% as determined by SDS-PAGE. | |
35.5 kDa | |
Mammalian cell |
> 95% by SDS-PAGE. | |
KMP1726, Recombinant Human GM-CSF R alpha/CSF2RA Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Glu23-Gly320) of human GM-CSF R alpha/CSF2RA (Accession #P15509) fused with a 6×His Tag at the C-terminus. |
Filter by Rating