Human CSF1 protein

• Catalog Number: orb594716
• Category: Proteins
• Description: Recombinant Human Macrophage colony-stimulating factor 1(CSF1),partial (Active)
• Tag: C-terminal 6xHis-tagged
• Form/Appearance: Lyophilized powder
• Purity: Greater than 95% as determined by SDS-PAGE.
• MW: 26.17 kDa
• UniProt ID: P09603
• Protein Sequence: EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPR
• Protein Length: Partial
• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: The ED50 as determined by its ability to acclerate M-NFS-60-dependent proliferation is less than 10 ng/ml
• Expression Region: 33-255aa
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2
• Alternative names: Macrophage Colony-Stimulating Factor 1; CSF-1; M-C
• Background: Macrophage Colony-Stimulating Factors (m-csf) are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and themonocytes-macrophages. CSF-1 promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. It also plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. CSF-1 is required for normal male and female fertility and promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. it also plays a role in lipoprotein clearance.
• Note: For research use only
• Application notes: Partial
• Expiration Date: 6 months from date of receipt.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.