You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb624085 |
---|---|
Category | Proteins |
Description | Recombinant Human C-type lectin domain family 4 member C protein |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 36 kDa |
UniProt ID | Q8WTT0 |
Protein Sequence | NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI |
Protein Length | Partial |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized CLEC4C protein at 1 μg/ml can bind human CLEC4C antibody, the EC50 of human CLEC4C antibody is 31.43-43.52 μg/ml. |
Expression Region | 45-213aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0 |
Alternative names | Blood dendritic cell antigen 2 ;BDCA-2;C-type lect Read more... |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
24 kDa | |
Mammalian cell |
Greater than 90% as determined by SDS-PAGE. | |
22 kDa | |
Yeast |
Unconjugated | |
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 20.8 kDa after removal of the signal peptide. The apparent molecular mass of CLEC4C-His is approximately 25-35 kDa due to glycosylation. | |
Mammalian |
Unconjugated | |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 46.1 kDa after removal of the signal peptide. The apparent molecular mass of hFc-CLEC4C is approximately 55-70 kDa due to glycosylation. | |
Mammalian |
≥90% as determined by SDS-PAGE | |
This protein contains the human CLEC4C(Asn45-IIe213) was fused with the C-terminal His Tag and expressed in Mammalian cells. |
Filter by Rating