You have no items in your shopping cart.
Cart summary
Human CLEC4C protein
Catalog Number: orb624085
| Catalog Number | orb624085 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human C-type lectin domain family 4 member C protein |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 36 kDa |
| UniProt ID | Q8WTT0 |
| Protein Sequence | NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI |
| Protein Length | Partial |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized CLEC4C protein at 1 μg/ml can bind human CLEC4C antibody, the EC50 of human CLEC4C antibody is 31.43-43.52 μg/ml. |
| Expression Region | 45-213aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0 |
| Alternative names | Blood dendritic cell antigen 2 ;BDCA-2;C-type lect Read more... |
| Note | For research use only |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Human CLEC4C protein [orb358925]
Greater than 90% as determined by SDS-PAGE.
24 kDa
Mammalian cell
500 μg, 20 μg, 100 μg, 1 mg - Item 1 of 1
Human CLEC4C protein [orb383167]
Greater than 90% as determined by SDS-PAGE.
22 kDa
Yeast
20 μg, 100 μg, 500 μg, 1 mg Human CLEC4C Protein, His Tag [orb1826832]
Unconjugated
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 20.8 kDa after removal of the signal peptide. The apparent molecular mass of CLEC4C-His is approximately 25-35 kDa due to glycosylation.
Mammalian
100 μg, 50 μg, 10 μgHuman CLEC4C Protein, hFc Tag [orb1290922]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 46.1 kDa after removal of the signal peptide. The apparent molecular mass of hFc-CLEC4C is approximately 55-70 kDa due to glycosylation.
Mammalian
50 μg, 10 μg, 100 μgRecombinant Human CD303/CLEC4C Protein, His Tag [orb1553172]
≥90% as determined by SDS-PAGE
This protein contains the human CLEC4C(Asn45-IIe213) was fused with the C-terminal His Tag and expressed in Mammalian cells.
100 μg, 50 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
