You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb383282 |
---|---|
Category | Proteins |
Description | Recombinant human CEACAM6 protein. |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 47.2 kDa |
UniProt ID | P40199 |
Protein Sequence | KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG |
Protein Length | Full Length of Mature Protein |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Expression Region | 35-320aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Non-specific crossreacting antigen, Normal cross-r Read more... |
Note | For research use only |
Application notes | E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length |
Expiration Date | 6 months from date of receipt. |
Greater than 95% as determined by SDS-PAGE. | |
32.6 kDa | |
Mammalian cell |
Human | |
0.83 ng/mL-20 ng/mL | |
0.33 ng/mL |
Unconjugated | |
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 32.1 kDa after removal of the signal peptide. The apparent molecular mass of CEACAM6-His is approximately 35-55 kDa due to glycosylation. | |
Mammalian |
Unconjugated | |
95% | |
32.0 kDa | |
Human CEACAM-6, His Tag (orb257336) is expressed from human 293 cells (HEK293). It contains AA Lys 35 - Gly 320 (Accession # NP_002474.3). |
≥90% as determined by SDS-PAGE | |
This protein contains the human CEACAM6(Met1-Gly320) was fused with the C-terminal His Tag and expressed in Mammalian cells. |
Filter by Rating