You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb245787 |
---|---|
Category | Proteins |
Description | Recombinant human CD70 antigen |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 19.1 kDa |
UniProt ID | P32970 |
Protein Sequence | QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP |
Protein Length | Extracellular Domain |
Source | Yeast |
Biological Origin | Homo sapiens (Human) |
Expression Region | 39-193 |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | CD70 Read more... |
Note | For research use only |
Application notes | This is His-tag protein |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 42.8 kDa after removal of the signal peptide. The apparent molecular mass of hFc-mCD70 is approximately 35-70 kDa due to glycosylation. | |
Mammalian |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
Unconjugated | |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 45.6 kDa after removal of the signal peptide. | |
Mammalian |
Unconjugated | |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 44.1 kDa after removal of the signal peptide. | |
Mammalian |
> 95% by Tris-Bis PAGE, > 95% by SEC-HPLC | |
KMP2099, Recombinant Human CD70/CD27 Ligand Trimer Protein is produced by Expi293 expression system. The target protein is expressed with sequence (Gln50-Pro193 Trimer) of Human CD70/CD27 Ligand Trimer fused with His Tag and Flag at the N-terminal. |
Filter by Rating