Human CD47 protein

• Catalog Number: orb594874
• Category: Proteins
• Description: Recombinant Human Leukocyte surface antigen CD47(CD47),partial (Active)
• Tag: C-terminal 6xHis-tagged
• Form/Appearance: Lyophilized powder
• Purity: Greater than 95% as determined by SDS-PAGE.
• MW: 14.76 kDa
• UniProt ID: Q08722
• Protein Sequence: QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP
• Protein Length: Partial
• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: The ED50 as determined by its ability to bind Human SIRPA in functional ELISA is less than 20 ug/ml.
• Expression Region: 19-139aa
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 10 mM Tris-Citrate, 150 mM NaCl, pH 8.0
• Alternative names: Leukocyte Surface Antigen CD47; Antigenic Surface
• Note: For research use only
• Application notes: Partial
• Expiration Date: 6 months from date of receipt.