Human CD40 protein

• Catalog Number: orb594872
• Category: Proteins
• Description: Recombinant Human Tumor necrosis factor receptor superfamily member 5(CD40),partial (Active)
• Tag: C-terminal Fc-tagged
• Form/Appearance: Lyophilized powder
• Purity: Greater than 95% as determined by SDS-PAGE.
• MW: 46.3 kDa
• UniProt ID: P25942
• Protein Sequence: EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR
• Protein Length: Extracellular Domain
• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: The ED50 as determined by its ability to bind Human TNFSF5 in functional ELISA is less than 20 ug/ml.
• Expression Region: 21-193aa
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
• Alternative names: Tumor Necrosis Factor Receptor Superfamily member
• Note: For research use only
• Application notes: Extracellular Domain
• Expiration Date: 6 months from date of receipt.