Cart summary

You have no items in your shopping cart.

    Human CCL25 protein (Active)

    Catalog Number: orb359082

    DispatchUsually dispatched within 1-2 weeks
    $ 2,546.00
    Catalog Numberorb359082
    CategoryProteins
    DescriptionRecombinant human CCL25 active protein
    TagTag-Free
    Form/AppearanceLyophilized powder
    Purity> 97% as determined by SDS-PAGE and HPLC.
    MW14.3 kDa
    UniProt IDO15444
    Protein SequenceM+QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL
    Protein LengthFull Length of Mature Protein
    SourceE.Coli
    Biological OriginHomo sapiens (Human)
    Biological ActivityFully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 1.0-10 ng/ml.
    Expression Region24-150aa
    EndotoxinsLess than 1.0 EU/µg as determined by LAL method.
    StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
    Buffer/PreservativesLyophilized from a 0.2 µm filtered PBS, pH 7.4
    Alternative namesChemokine TECK, Thymus-expressed chemokine
    Read more...
    BackgroundPotentially involved in T-cell development. Recombinant protein shows chemotactic activity on thymocytes, macrophages, THP-1 cells, and dendritics cells but is inactive on peripheral blood lymphocytes and neutrophils. Binds to CCR9. Isoform 2 is an antagonist of isoform 1. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.
    NoteFor research use only
    Application notesWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
    Expiration Date6 months from date of receipt.
    Human CCL25 protein (Active)

    SDS-PAGE analysis of Human CCL25 protein (Active)

    Human CCL25 protein (Active)

    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars