You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb359043 |
---|---|
Category | Proteins |
Description | Recombinant human CCL15 active protein |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Purity | > 97% as determined by SDS-PAGE and HPLC. |
MW | 10.2 kDa |
UniProt ID | Q16663 |
Protein Sequence | QFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI |
Protein Length | Full Length of Mature Protein |
Source | E.Coli |
Biological Origin | Homo sapiens (Human) |
Biological Activity | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 1.0-10 ng/ml. |
Expression Region | 22-113aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
Alternative names | Chemokine CC-2, Leukotactin-1, LKN-1, MIP-1 delta, Read more... |
Background | Chemotactic factor that attracts T-cells and monocytes, but not neutrophils, eosinophils, or B-cells. Acts mainly via CC chemokine receptor CCR1. Also binds to CCR3. CCL15(22-92), CCL15(25-92) and CCL15(29-92) are more potent chemoattractants than the small-inducible cytokine A15. {ECO:0000269|PubMed:15905581}. |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Expiration Date | 6 months from date of receipt. |
SDS-PAGE analysis of Human CCL15 protein (Active)
> 98% as determined by SDS-PAGE and HPLC. | |
7.4 kDa | |
E.Coli |
Approximately 11.5 kDa, a single non-glycosylated polypeptide chain containing 101 amino acids. | |
Escherichia coli. |
10.2 kDa, observed by reducing SDS-PAGE. | |
Escherichia coli. |
Filter by Rating