You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594918 |
---|---|
Category | Proteins |
Description | Recombinant Human Carbonic anhydrase 5B, mitochondrial(CA5B) (Active) |
Tag | C-terminal 6xHis-tagged |
Form/Appearance | Liquid |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 33.77 kDa |
UniProt ID | Q9Y2D0 |
Protein Sequence | CSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP |
Protein Length | Full Length of Mature Protein |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Biological Activity | The esterase activity is determined to be greater than 1000 pmol/min/ug |
Expression Region | 34-317aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | 0.2 μm filtered 20 mM Tris-HCl, 100 mM NaCl, pH 8.0 |
Alternative names | Carbonic Anhydrase 5B Mitochondrial; Carbonate Deh Read more... |
Note | For research use only |
Application notes | Full Length of Mature Protein |
Expiration Date | 6 months from date of receipt. |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | |
E. coli |
≥90% as determined by SDS-PAGE | |
This protein contains the human CA5B(Cys34-Pro317) was fused with the C-terminal His Tag and expressed in E. coli. |
ELISA, WB | |
Greater than 95% as determined by SDS-PAGE | |
31.1 kDa | |
E.Coli |
Filter by Rating