Human CA5B protein

Catalog Number: orb594918

Catalog Number	orb594918
Category	Proteins
Description	Recombinant Human Carbonic anhydrase 5B, mitochondrial(CA5B) (Active)
Tag	C-terminal 6xHis-tagged
Form/Appearance	Liquid
Purity	Greater than 95% as determined by SDS-PAGE.
MW	33.77 kDa
UniProt ID	Q9Y2D0
Protein Sequence	CSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP
Protein Length	Full Length of Mature Protein
Source	E.coli
Biological Origin	Homo sapiens (Human)
Biological Activity	The esterase activity is determined to be greater than 1000 pmol/min/ug
Expression Region	34-317aa
Endotoxins	Less than 1.0 EU/µg as determined by LAL method.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	0.2 μm filtered 20 mM Tris-HCl, 100 mM NaCl, pH 8.0
Alternative names	Carbonic Anhydrase 5B Mitochondrial; Carbonate Deh Read more...
Note	For research use only
Application notes	Full Length of Mature Protein
Expiration Date	6 months from date of receipt.

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Source:	E. coli

Purity:	≥90% as determined by SDS-PAGE
Source:	This protein contains the human CA5B(Cys34-Pro317) was fused with the C-terminal His Tag and expressed in E. coli.

Applications:	ELISA, WB
Purity:	Greater than 95% as determined by SDS-PAGE
MW:	31.1 kDa
Source:	E.Coli