You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb382941 |
---|---|
Category | Proteins |
Description | Recombinant human BTC protein. |
Tag | N-terminal GST-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 43.6 kDa |
UniProt ID | P35070 |
Protein Sequence | DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQILVICLIAVMVVFIILVIGVCTCCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA |
Protein Length | Full Length of Mature Protein |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Expression Region | 32-178aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | BTCProbetacellulin [Cleaved into, Betacellulin, BT Read more... |
Note | For research use only |
Application notes | E.coli and Yeast N-terminal GST-tagged Full Length |
Expiration Date | 6 months from date of receipt. |
> 98% as determined by SDS-PAGE and HPLC. | |
9.0 kDa | |
E.Coli |
HPLC, SDS-PAGE | |
Unconjugated | |
> 96% by SDS-PAGE and HPLC analyses | |
9.0 kDa |
Unconjugated | |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 35.1 kDa after removal of the signal peptide. The apparent molecular mass of BTC-hFc is approximately 35-70 kDa due to glycosylation. | |
Mammalian |
Greater than 90% as determined by SDS-PAGE. | |
18.6 kDa | |
Yeast |
Filter by Rating