You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb624100 |
---|---|
Category | Proteins |
Description | Recombinant Human Basigin protein |
Tag | C-terminal 6xHis-Myc-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 24.9 kDa |
UniProt ID | P35613 |
Protein Sequence | EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLA |
Protein Length | Partial |
Source | Mammalian cell |
Biological Origin | Homo sapiens (Human) |
Expression Region | 138-323aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | 5A11 antigen, 5F7, BASI_HUMAN, Basigin (Ok blood g Read more... |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Expiration Date | 6 months from date of receipt. |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | |
Human cells |
Unconjugated | |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 46.3 kDa after removal of the signal peptide.The apparent molecular mass of CD147-hFc is approximately 55-70 kDa due to glycosylation. | |
Mammalian |
Greater than 90% as determined by SDS-PAGE. | |
24.2 kDa | |
E.coli |
Greater than 85% as determined by SDS-PAGE. | |
49.3 kDa | |
Mammalian cell |
Filter by Rating