Human Brain Natriuretic Peptide (rHuBNP )

• Catalog Number: orb1495068
• Category: Proteins
• Description: Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function.
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• MW: 3464 Da, a single non-glycosylated polypeptide chain containing 32 amino acids.
• Protein Sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
• Source: Escherichia coli.
• Biological Activity: Data Not Available.
• Endotoxins: Less than 1EU/g of rHuCNTF as determined by LAL method.
• Storage: This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
• Buffer/Preservatives: Lyophilized from a 0.2m filtered concentrated solution in PBS, pH 7.4.
• Note: For research use only
• Application notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions.
• Expiration Date: 6 months from date of receipt.