Human BDNF protein

• Catalog Number: orb594732
• Category: Proteins
• Description: Recombinant Human Brain-derived neurotrophic factor(BDNF) (Active)
• Tag: Tag-Free
• Form/Appearance: Lyophilized powder
• Purity: Greater than 95% as determined by SDS-PAGE.
• MW: 13 kDa
• UniProt ID: P23560
• Protein Sequence: HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
• Protein Length: Full Length of Mature Protein
• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Biological Activity: The ED50 as determined by its ability to bind Human TrkB in functional ELISA is less than 5 ug/ml.
• Expression Region: 129-247aa
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 20 mM PB, 250 mM NaCl, pH 7.2
• Alternative names: Brain-Derived Neurotrophic Factor; BDNF; Abrineuri
• Note: For research use only
• Application notes: Full Length of Mature Protein
• Expiration Date: 6 months from date of receipt.