You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb603900 |
---|---|
Category | Proteins |
Description | Recombinant Human Alkaline phosphatase, placental type(ALPP),partial |
Tag | N-terminal 10xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 85% as determined by SDS-PAGE. |
MW | 41.9 kDa |
UniProt ID | P05187 |
Protein Sequence | TATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAV |
Protein Length | Partial |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Expression Region | 117-447aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Alkaline phosphatase Regan isozyme Placental alkal Read more... |
Note | For research use only |
Application notes | Partial |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 53.5 kDa after removal of the signal peptide. The apparent molecular mass of ALPP-His is approximately 55-70 kDa due to glycosylation. | |
Mammalian |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | |
Human cells |
Greater than 85% as determined by SDS-PAGE. | |
38.9 kDa | |
Baculovirus |
≥90% as determined by SDS-PAGE | |
This protein contains the human ALPP(Ile23-Asp506) was fused with the C-terminal His Tag and expressed in Mammalian cells. |
Filter by Rating