You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1477845 |
---|---|
Category | Proteins |
Description | Recombinant Human Intestinal-type alkaline phosphatase(ALPI) (Active) |
Tag | N-terminal 10xHis-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 55.2 kDa |
UniProt ID | P09923 |
Protein Sequence | VIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVFNSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPYTACDLAPPACTTD |
Protein Length | Full Length of Mature Protein |
Source | Mammalian cell |
Biological Origin | Homo sapiens (Human) |
Biological Activity | Unit Definition: One unit is defined as the amount of enzyme required to cleave 1 nmol p-nitro-phenylphosphate (pNPP), in 1 minute at 37°C, pH10.0. The specific activity is > 8836.463 U/mg. |
Expression Region | 20-503aa |
Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Alternative names | (IAP)(Intestinal alkaline phosphatase) Read more... |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 53.5 kDa after removal of the signal peptide. The apparent molecular mass of ALPP-His is approximately 55-70 kDa due to glycosylation. | |
Mammalian |
Greater than 90% as determined by SDS-PAGE. | |
55.5 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
54.4 kDa | |
Yeast |
Greater than 85% as determined by SDS-PAGE. | |
58.4 kDa | |
E.coli |
≥90% as determined by SDS-PAGE | |
This protein contains the human ALPP(Ile23-Asp506) was fused with the C-terminal His Tag and expressed in Mammalian cells. |
Filter by Rating