You have no items in your shopping cart.
Cart summary
Human ADAMTS2 protein
Catalog Number: orb603891
| Catalog Number | orb603891 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 2(ADAMTS2),partial |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 32.2 kDa |
| UniProt ID | O95450 |
| Protein Sequence | RRRARRHAADDDYNIEVLLGVDDSVVQFHGKEHVQKYLLTLMNIVNEIYHDESLGAHINVVLVRIILLSYGKSMSLIEIGNPSQSLENVCRWAYLQQKPDTGHDEYHDHAIFLTRQDFGPSGMQGYAPVTGMCHPVRSCTLNHEDGFSSAFVVAHETGHVLGMEHDGQGNRCGDEVRLGSIMAPLVQAAFHRFHWSRCSQQELSRYLHSYDCLLDDPFAHDWPALPQLPGLHYSMNEQC |
| Protein Length | Partial |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 254-492aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | Procollagen I N-proteinase (PC I-NP) (Procollagen Read more... |
| Note | For research use only |
| Application notes | Partial |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Human ADAMTS4 ELISA Kit [orb405624]
Human
12.5 ng/ml - 800 ng/ml
3.125 ng/ml
24 T, 48 T, 96 T, 10 x 96 T, 5 x 96 TADAMTS14 Protein, Human, Recombinant (His) [orb1979047]
98.00%
40.2 kDa (predicted)
1 mg, 100 μg, 20 μgRecombinant human ADAMTS2 Protein,C-hFc & C-His (HEK293) [orb2328344]
> 85% as determined by SDS-PAGE
20 μg, 50 μg, 100 μg
