You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594924 |
---|---|
Category | Proteins |
Description | Recombinant Human Activin receptor type-2B(ACVR2B),partial (Active) |
Tag | C-terminal 6xHis-Fc-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 41.3 kDa |
UniProt ID | Q13705 |
Protein Sequence | SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPT |
Protein Length | Partial |
Source | Mammalian cell |
Biological Origin | Homo sapiens (Human) |
Biological Activity | The ED50 as determined by its ability to bind Human Activin A in functional ELISA is less than 100 ng/ml. |
Expression Region | 19-134aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
Alternative names | Activin Receptor Type-2B; Activin Receptor Type II Read more... |
Note | For research use only |
Application notes | Partial |
Expiration Date | 6 months from date of receipt. |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
Unconjugated | |
90% | |
14.5 kDa | |
Human Activin RIIB, His Tag (orb257168) is expressed from human 293 cells (HEK293). It contains AA Ser 19 - Thr 137 (Accession # Q13705-1). |
Greater than 90% as determined by SDS-PAGE. | |
15.7 kDa | |
Yeast |
Greater than 85% as determined by SDS-PAGE. | |
27.7 kDa | |
E.coli |
Filter by Rating