You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb358334 |
---|---|
Category | Proteins |
Description | Recombinant human ACVR2B protein |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 15.7 kDa |
UniProt ID | Q13705 |
Protein Sequence | SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTLLT |
Protein Length | Extracellular Domain |
Source | Yeast |
Biological Origin | Homo sapiens (Human) |
Expression Region | 19-137aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Activin receptor type IIB Short name, ACTR-IIB Read more... |
Note | For research use only |
Application notes | This is His-tag protein |
Expiration Date | 6 months from date of receipt. |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
Unconjugated | |
90% | |
14.5 kDa | |
Human Activin RIIB, His Tag (orb257168) is expressed from human 293 cells (HEK293). It contains AA Ser 19 - Thr 137 (Accession # Q13705-1). |
Greater than 95% as determined by SDS-PAGE. | |
41.3 kDa | |
Mammalian cell |
Greater than 85% as determined by SDS-PAGE. | |
27.7 kDa | |
E.coli |
Filter by Rating