HTR2B antibody

• Catalog Number: orb573678
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HTR2B
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HTR2B
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 54 kDa
• Target: HTR2B
• UniProt ID: P41595
• Protein Sequence: Synthetic peptide located within the following region: QTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKK
• NCBI: NP_000858
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: 5-HT2B, 5-HT-2B, 5-HT(2B)
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.4 ug/ml of the antibody was used in this experiment. In addition to the 54 kDa canonical protein, isoforms of 51 kDa and 50 kDa also contain this peptide. Proteins may be lipidated and/or glycosylated as well.

Host: Rabbit, Target Name: HTR2B, Sample Tissue: Human 293T Whole Cell, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: HTR2B, Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: HTR2B, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: HTR2B, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: HTR2B, Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.

Immunofluorescence: 1.3 ug/ml.

WB Suggested Anti-HTR2B Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: 721_B cell lysate, HTR2B is supported by BioGPS gene expression data to be expressed in 721_B.