HTR1A antibody

• Catalog Number: orb592791
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HTR1A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HTR1A
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 46kDa
• Target: HTR1A
• UniProt ID: P08908
• Protein Sequence: Synthetic peptide located within the following region: GQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNAC
• NCBI: NP_000515
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: G-21, 5HT1a, PFMCD, 5-HT1A, 5-HT-1A, ADRBRL1, ADRB
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: HTR1A, Sample Type: Jurkat Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: HTR1A, Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1.0 ug/ml, Peptide Concentration: 1.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

HTR1A antibody - N-terminal region (orb592791) validated by WB using primary cultured neurons.