You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581618 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to HSPH1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human HSPH1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 97kDa |
Target | HSPH1 |
UniProt ID | Q92598 |
Protein Sequence | Synthetic peptide located within the following region: EENEMSSEADMECLNQRPPENPDTDKNVQQDNSEAGTQPQVQTDAQQTSQ |
NCBI | NP_006635 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | HSP105, HSP105A, HSP105B, NY-CO-25 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: HSPH1, Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. HSPH1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Host: Rabbit, Target Name: HSPH1, Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: HSPH1, Sample Type: Human MCF7, Antibody dilution: 1.0 ug/ml. HSPH1 is strongly supported by BioGPS gene expression data to be expressed in MCF7.
Rabbit Anti-HSPH1 Antibody, Catalog Number: orb581618, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm in endothelial cells in sinusoids, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-HSPH1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 293T cell lysate.
FC, ICC, IF, IHC, WB | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
ELISA, FC, ICC, IF, IHC, IHC-Fr, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IF, IHC, IHC-Fr, WB | |
Hamster | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating