HSPA9 antibody

• Catalog Number: orb573591
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HSPA9
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, IP, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit
• Reactivity: Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HSPA9
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 75kDa
• Target: HSPA9
• UniProt ID: P38646
• Protein Sequence: Synthetic peptide located within the following region: GENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ
• NCBI: NP_004125
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CSA, MOT, MOT2, SAAN, CRP40, EVPLS, GRP75, PBP74,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Amount and Sample Type: 500 ug mouse brain homogenate, Amount of IP Antibody: 6 ug, Primary Antibody: HSPA9, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody dilution: 1:5000, Gene Name: HSPA9.

Sample Type: rat brain extract (80 ug), Primary antibody dilution: 2 ug/ml, Secondary antibody: IRDye 800CW goat anti-rabbit, Secondary antibody dilution: 1:20000.

Sample Type: Human brain stem cells, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: HSPA9: Red DAPI:Blue, Gene Name: HSPA9.

Sample Type: Human brain stem cells, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: HSPA9: Red DAPI:Blue, Gene Name: HSPA9.

Skeletal muscle

WB Suggested Anti-HSPA9 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 293T cell lysate, HSPA9 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.