HSPA8 antibody

• Catalog Number: orb330555
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HSPA8
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Goat, Human, Mouse, Rat, Yeast, Zebrafish
• Reactivity: Equine, Goat, Human, Mouse, Rat, Yeast, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HSPA8
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 71kDa
• Target: HSPA8
• UniProt ID: P11142
• Protein Sequence: Synthetic peptide located within the following region: VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE
• NCBI: NP_006588
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti HSC54 antibody, anti HSC70 antibody, anti HSC
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of human Tonsil tissue using HSPA8 antibody

Immunohistochemical staining of human Spleen tissue using HSPA8 antibody

Immunohistochemical staining of human Brian tissue using HSPA8 antibody

Western blot analysis of COLO205 cell lysate tissue using HSPA8 antibody

Western blot analysis of rat Brain Lysate tissue using HSPA8 antibody

Titer: 1:1000, Positive Control: Rat Brain Lysate.

Anti-HSPA8 / HSC70 antibody IHC staining of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibodyconcentration 5 ug/ml.

Anti-HSPA8 / HSC70 antibody IHC staining of human tonsil. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Application: IHC, Species+tissue/cell type: Human brain stem cells, Primary antibody dilution: 1:500, Secondary antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary antibody dilution: 1:1000.

WB Suggested Anti-HSPA8 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: COLO205 cell lysate.