HSPA8 antibody

• Catalog Number: orb330554
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HSPA8
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Goat, Porcine, Sheep, Zebrafish
• Reactivity: Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HSPA8
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 71kDa
• Target: HSPA8
• UniProt ID: P11142
• Protein Sequence: Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL
• NCBI: NP_006588
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti HSC54 antibody, anti HSC70 antibody, anti HSC
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of 293T cell lysate tissue using HSPA8 antibody

Immunohistochemical staining of mouse brain tissue using HSPA8 antibody

Immunohistochemical staining of human Pineal tissue using HSPA8 antibody

Western blot analysis of rat Brain tissue using HSPA8 antibody

Western blot analysis of human 293T tissue using HSPA8 antibody

Sample Type: Mouse Brain Slices, Red: primary, Blue: DAPI, Primary, dilution: 1:400, Secondary Antibody: Anti-Rabbit IgG Alexa 594, Secondary, dilution: 1:400.

25 ug of the indicated Human whole cell tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Host: Rabbit, Target Name: HIRIP3, Sample Type: 293T, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: HSPA8, Sample Tissue: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: HSPA8, Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 0.5 ug/ml.

Host: Rabbit, Target Name: HSPA8, Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: HSPA8, Sample Type: Human 293T cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5.0 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 12%.

Host: Rabbit, Target Name: NOP56, Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. HSPA8 is strongly supported by BioGPS gene expression data to be expressed in MCF7.

Host: Rabbit, Target Name: RHOT1, Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml. HSPA8 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

HSPA8 antibody - N-terminal region (orb330554) validated by WB using Rat Brain lysate at 1:1000.

Rabbit Anti-HSPA8 Antibody, Catalog Number: orb330554, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Nuclear in pinealocytes, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-HSPA8 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 293T cell lysate.