You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb443135 |
---|---|
Category | Antibodies |
Description | HSPA2 Antibody (monoclonal, 4A4) |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 4A4 |
Tested applications | FC, ICC, IF, IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Mouse IgG1 |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human HSPA2 (564-598aa KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK), identical to the related mouse and rat sequences. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 70 kDa |
UniProt ID | P54652 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Heat shock-related 70 kDa protein 2; Heat shock 70 Read more... |
Note | For research use only |
Application notes | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of PC-3 cells using anti-HSPA2 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of HSPA2 using anti-HSPA2 antibody.Lane 1:human HeLa Cell;2:human MDA-MB-231 Cell;3:human COLO-320 Cell;4:human PANC-1 Cell.5:human HT1080 Cell;6:human MDA-MB-453 Cell;7:human HepG2 Cell.
WB analysis of HSPA2 using anti-HSPA2 antibody.Lane 1:rat lung tissue;2:rat liver tissue;3:rat kidney tissue;4:rat testicular tissue;5:mouse lung tissue;6:mouse liver tissue;7:mouse kidney tissue;8:mouse testicular tissue;9:mouse RAW246.7 cell.
IF analysis of HSPA2 using anti-HSPA2 antibody.HSPA2 was detected in immunocytochemical section of PC-3 cells.
IHC analysis of HSPA2 using anti-HSPA2 antibody.HSPA2 was detected in paraffin-embedded section of human lung cancer tissue.
Filter by Rating