HSPA1L antibody

• Catalog Number: orb582161
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HSPA1L
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Mouse, Porcine
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HSPA1L
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 70kDa
• Target: HSPA1L
• UniProt ID: P34931
• Protein Sequence: Synthetic peptide located within the following region: DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD
• NCBI: NP_005518
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HSP70T, hum70t, HSP70-1L, HSP70-HOM
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: 1. Lamprey CNS (20 ug), 2. Rat Brain Lysate (20 ug), Primary dilution: 1:1000, Secondary Antibody: Goat anti-Rabbit HRP, Secondary dilution: 1:4000.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.2 ug/ml of the antibody was used in this experiment.

Host: Rabbit, Target Name: HSPA1L, Sample Tissue: Human MDA-MB-435s, Antibody dilution: 1.0 ug/ml.

HSPA1L was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb582161 with 1:200 dilution. Western blot was performed using orb582161 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: HSPA1L IP with orb582161 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

Rabbit Anti-HSPA1L antibody, Formalin Fixed Paraffin Embedded Tissue: Human Testis, Primary antibody Concentration: 1:200, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-HSPA1L Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.