HSP90AA1 antibody

• Catalog Number: orb573596
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HSP90AA1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep
• Reactivity: Animal, Bovine, Guinea pig, Human, Mouse, Rat, Sheep
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HSP90AA1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 98kDa
• Target: HSP90AA1
• UniProt ID: P07900
• Protein Sequence: Synthetic peptide located within the following region: HLYKDLQPFILLRLLMPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIIN
• NCBI: NP_001017963
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: EL52, HSPN, LAP2, HSP86, HSPC1, HSPCA, Hsp89, Hsp9
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: HSP90AA1, Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.

Anti-HSP90AA1 / Hsp90 antibody IHC staining of human colon, myenteric plexus. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Anti-HSP90AA1 / Hsp90 antibody IHC staining of human tonsil. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Host: Mouse, Target Name: HSP90AA1, Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.

Rabbit Anti-HSP90AA1 Antibody, Catalog Number: orb573596, Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue, Observed Staining: Cytoplasm, Plasma membrane, Primary Antibody Concentration: 1:600, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-HSP90AA1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: MCF7 cell lysate, HSP90AA1 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.