Cart summary

You have no items in your shopping cart.

    Hsp90 beta/HSP90AB1 Antibody

    Catalog Number: orb315144

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb315144
    CategoryAntibodies
    DescriptionHsp90 beta/HSP90AB1 Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsICC, IF, IHC, WB
    Predicted ReactivityHamster
    ReactivityHuman, Mouse, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human Hsp90 beta (449-481aa RRLSELLRYHTSQSGDEMTSLSEYVSRMKETQK), identical to the related mouse and rat sequences.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW83264 MW
    UniProt IDP08238
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesHeat shock protein HSP 90-beta;HSP 90;Heat shock 8
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    Hsp90 beta/HSP90AB1 Antibody

    WB analysis of HSP90AB1 using anti-HSP90AB1 antibody.Lane 1:human A549 cell; 2:human HeLa cell; 3:human Jurkat cell; 4:human K562 cell; 5:human HEK293 cell;6:rat PC-12 cell; 7:mouse NIH/3T3 cell; 8:mouse ANA-1 cell.

    Hsp90 beta/HSP90AB1 Antibody

    IF analysis of HSP90AB1 using anti-HSP90AB1 antibody.HSP90AB1 was detected in paraffin-embedded section of human lung cancer tissues.

    Hsp90 beta/HSP90AB1 Antibody

    IF analysis of HSP90AB1 using anti-HSP90AB1 antibody.HSP90AB1 was detected in paraffin-embedded section of human lung cancer tissues.

    Hsp90 beta/HSP90AB1 Antibody

    IF analysis of HSP90AB1 using anti-HSP90AB1 antibody.HSP90AB1 was detected in paraffin-embedded section of mouse brain tissues.

    Hsp90 beta/HSP90AB1 Antibody

    IF analysis of HSP90AB1 using anti-HSP90AB1 antibody.HSP90AB1 was detected in paraffin-embedded section of mouse brain tissues.

    Hsp90 beta/HSP90AB1 Antibody

    IF analysis of HSP90AB1 using anti-HSP90AB1 antibody.HSP90AB1 was detected in immunocytochemical section of A431 cells.

    Hsp90 beta/HSP90AB1 Antibody

    IHC analysis of HSP90AB1 using anti-HSP90AB1 antibody.HSP90AB1 was detected in paraffin-embedded section of human placenta tissues.

    Hsp90 beta/HSP90AB1 Antibody

    IHC analysis of HSP90AB1 using anti-HSP90AB1 antibody.HSP90AB1 was detected in paraffin-embedded section of mouse testis tissues.

    Hsp90 beta/HSP90AB1 Antibody

    IHC analysis of HSP90AB1 using anti-HSP90AB1 antibody.HSP90AB1 was detected in paraffin-embedded section of rat intestine tissues.

    • Hsp90 beta/HSP90AB1 Antibody (monoclonal, 7B7F5) [orb1474875]

      FC,  ICC,  IF,  WB

      Human, Mouse, Rat

      Mouse

      Monoclonal

      Unconjugated

      10 μg, 100 μg
    • Hsp90 beta HSP90AB1 Rabbit Monoclonal Antibody [orb547828]

      ICC,  IF,  IHC,  WB

      Human, Mouse, Rat

      Rabbit

      Monoclonal

      Unconjugated

      30 μl, 100 μl
    • Hsp90 beta HSP90AB1 Rabbit Monoclonal Antibody [orb547829]

      FC,  ICC,  IF,  IHC,  IP,  WB

      Human, Mouse, Rat

      Rabbit

      Monoclonal

      Unconjugated

      30 μl, 100 μl
    • HSP90AB1 Antibody [orb1253471]

      WB

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      0.1 mg
    • Hsp90 beta (phospho-Ser226) antibody [orb184233]

      FC

      Mouse, Rat

      Human

      Rabbit

      Polyclonal

      Unconjugated

      50 μl, 100 μl, 200 μl
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars