You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1474875 |
---|---|
Category | Antibodies |
Description | Hsp90 beta/HSP90AB1 Antibody (monoclonal, 7B7F5) |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 7B7F5 |
Tested applications | FC, ICC, IF, WB |
Reactivity | Human, Mouse, Rat |
Isotype | IgG2b |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp90 beta (449-481aa RRLSELLRYHTSQSGDEMTSLSEYVSRMKETQK), identical to the related mouse and rat sequences. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 90 kDa |
UniProt ID | P08238 |
Storage | At -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freezing and thawing. |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Expiration Date | 12 months from date of receipt. |
IF analysis of Hsp90 beta/HSP90AB1 using anti-Hsp90 beta/HSP90AB1 antibody. Hsp90 beta/HSP90AB1 was detected in an immunocytochemical section of MCF-7 cells.
Western blot analysis of Hsp90 beta/HSP90AB1 using anti-Hsp90 beta/HSP90AB1 antibody.
Flow Cytometry analysis of CACO-2 cells using anti-Hsp90 beta/HSP90AB1 antibody(Blue line).Isotype control antibody(Green line) was mouse IgG.Unlabelled sample(Red line) was also used as a control.
Filter by Rating