Hsp70/HSPA1A/HSPA1B Antibody

• Catalog Number: orb315146
• Category: Antibodies
• Description: Hsp70/HSPA1A/HSPA1B Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, WB
• Predicted Reactivity: Bovine, Equine, Monkey
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp70 (559-596aa KGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKR), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 70052 MW
• UniProt ID: P0DMV8
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Heat shock 70 kDa protein 1A ;Heat shock 70 kDa pr
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of HeLa cells using anti-Hsp70 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB:Lane 1:human HeLa cell;2:human A549 cell;3:human HepG2 cell;4:huamn CACO-2 cell;5:huamn SW620 cell;6:huamn PANC-1 cell;7:huamn Raji cell;8:rat brain tissue;9:rat kidney tissue;10:mosue kidney tissue;11:mouse NIH/3T3 cell;12:mosue RAW264.7 cell.

IF analysis of Hsp70 using anti-Hsp70 antibody. Hsp70 was detected in immunocytochemical section of MCF-7 cells.

IHC analysis of Hsp70 using anti-Hsp70 antibody. Hsp70 was detected in a paraffin-embedded section of rat intestine tissue.

IHC analysis of Hsp70 using anti-Hsp70 antibody. Hsp70 was detected in a paraffin-embedded section of mouse intestine tissue.

IHC analysis of Hsp70 using anti-Hsp70 antibody. Hsp70 was detected in a paraffin-embedded section of human lung cancer tissue.