HSD17B1 monoclonal antibody (M03), clone 2E5

• Catalog Number: orb2292771
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant HSD17B1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2E5
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: HSD17B1 (NP_000404, 189 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: VHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVF
• NCBI: NP_000404
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged HSD17B1 is 0.03 ng/ml as a capture antibody.

HSD17B1 monoclonal antibody (M03), clone 2E5 Western Blot analysis of HSD17B1 expression in Jurkat.

Immunoperoxidase of monoclonal antibody to HSD17B1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]

Western Blot detection against Immunogen (36.41 KDa).