You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578036 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to HRG |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Rabbit |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human HRG |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 60kDa |
Target | HRG |
UniProt ID | P04196 |
Protein Sequence | Synthetic peptide located within the following region: EVLPLPEANFPSFPLPHHKHPLKPDNQPFPQSVSESCPGKFKSGFPQVSM |
NCBI | NP_000403 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | HPRG, HRGP, THPH11 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: HRG, Sample Type: Human Liver, Antibody Dilution: 1.0 ug/ml.
WB Suggested Anti-HRG Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.
ICC, IHC, WB | |
Hamster | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, IHC-P, WB | |
Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating