HOXC8 antibody

• Catalog Number: orb577172
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HOXC8
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HOXC8
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 28kDa
• Target: HOXC8
• UniProt ID: P31273
• Protein Sequence: Synthetic peptide located within the following region: SHALVYGPGGSAPGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGD
• NCBI: NP_073149
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HOX3, HOX3A
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Anti-HOXC8 antibody IHC staining of human colon. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Anti-HOXC8 antibody IHC staining of human small intestine. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Rabbit Anti-HOXC8 Antibody, Paraffin Embedded Tissue: Human Colon, Antibody Concentration: 5 ug/ml.

WB Suggested Anti-HOXC8 Antibody Titration: 1 ug/ml, Positive Control: Fetal Muscle cell lysate.