HOXC4 antibody

• Catalog Number: orb573984
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HOXC4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HOXC4
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 29kDa
• Target: HOXC4
• UniProt ID: P09017
• Protein Sequence: Synthetic peptide located within the following region: MIMSSYLMDSNYIDPKFPPCEEYSQNSYIPEHSPEYYGRTRESGFQHHHQ
• NCBI: NP_705897
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HOX3, cp19, HOX3E
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Mouse, Target Name: HOXC4, Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

WB Suggested Anti-HOXC4 Antibody Titration: 2.0 ug/ml, Positive Control: Human Liver.