HOXB3 antibody

• Catalog Number: orb573736
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HOXB3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HOXB3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 44kDa
• Target: HOXB3
• UniProt ID: P14651
• Protein Sequence: Synthetic peptide located within the following region: GPSKSGPPKCGPGTNSTLTKQIFPWMKESRQTSKLKNNSPGTAEGCGGGG
• NCBI: NP_002137
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HOX2, HOX2G, Hox-2.7
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: HOXB3, Sample Type: HepG2, Antibody dilution: 1.0 ug/ml. HOXB3 is supported by BioGPS gene expression data to be expressed in HepG2.

Host: Rabbit, Target: HOXB3, Positive control (+): Hela (HL), Negative control (-): Human heart muscle, Antibody concentration: 1 ug/ml.

WB Suggested Anti-HOXB3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate, HOXB3 is supported by BioGPS gene expression data to be expressed in HepG2.

WB Suggested Anti-HOXB3 antibody Titration: 1 ug/ml, Sample Type: Human heart.