HOXA5 antibody

• Catalog Number: orb330051
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HOXA5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HOXA5
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 29 kDa
• Target: HOXA5
• UniProt ID: A2D5Y4
• Protein Sequence: Synthetic peptide located within the following region: FNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSMAAAG
• NCBI: NP_061975
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti HOX1 antibody, anti HOX1.3 antibody, anti HOX
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of human breast tissue using HOXA5 antibody

Immunohistochemical staining of human Breast tissue using HOXA5 antibody

Western blot analysis of human Placenta tissue using HOXA5 antibody

Immunohistochemical staining of human Kidney tissue using HOXA5 antibody

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.

Anti-HOXA5 antibody IHC staining of human breast. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.

Anti-HOXA5 antibody IHC staining of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.

Host: Mouse, Target Name: HOXA5, Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: HOXA5, Sample Tissue: Human RPMI 8226 Whole Cell, Antibody Dilution: 5 ug/mL.

Host: Rabbit, Target: HOXA5, Positive control (+): THP-1 (N30), Negative control (-): HeLa (HL), Antibody concentration: 1 ug/mL.

Rabbit Anti-HOXA5 Antibody, Paraffin Embedded Tissue: Human Breast, Antibody Concentration: 5 ug/mL.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

WB Suggested Anti-HOXA5 Antibody Titration: 1 ug/mL, Positive Control: Placenta.