You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329606 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to HOXA5 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Animal, Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat |
Reactivity | Canine, Equine, Human, Mouse, Porcine, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human HOXA5 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 29kDa |
Target | HOXA5 |
UniProt ID | Q6FG31 |
Protein Sequence | Synthetic peptide located within the following region: VGTASGAEEDAPASSEQASAQSEPSPAPPAQPQIYPWMRKLHISHDNIGG |
NCBI | NP_061975 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti HOX1 antibody, anti HOX1.3 antibody, anti HOX Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Immunohistochemical staining of mouse skin tissue using HOXA5 antibody
Western blot analysis of 721_B cell lysate tissue using HOXA5 antibody
Immunohistochemical staining of human kidney tissue using HOXA5 antibody
Human kidney
Sample Type: Mouse dorsal skin -5d postnatal, Primary Antibody Dilution: 1:200, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: Brown: HOXA5, Gene Name: HOXA5.
WB Suggested Anti-HOXA5 Antibody Titration: 0.2-1 ug/mL, Positive Control: 721_B cell lysate.
IHC, WB | |
Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish | |
Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Drosophila, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating