You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577552 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to HNRPL |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IF, IHC, IP, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HNRPL |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 65kDa |
Target | HNRNPL |
UniProt ID | P14866 |
Protein Sequence | Synthetic peptide located within the following region: AAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYV |
NCBI | NP_001524 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | HNRPL, hnRNP-L, P/OKcl.14 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Amount and Sample Type: Lane 1: 5% Input, Lane 2: 5% Sup, Lane 3: Normal IgG, Lane 4: hn-RNPL ppt. k562 sample, IP Antibody: HNRPL, Amount of IP Antibody, Primary Antibody: HNRPL, Primary Antibody Dilution: 1:4000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: HNRPL.
Host: Mouse, Target Name: HNRNPL, Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target Name: HNRNPL, Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/ml.
Lane 1: 20 ug HeLa S3 lysate, Lane 2: 20 ug MCF7 lysate, Lane 3: 20 ug K562 lysate, Primary Antibody Dilution: 1:4000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: HNRPL.
Rabbit Anti-HNRPL antibody, Paraffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
Rabbit Anti-HNRPL Antibody, Paraffin Embedded Tissue: Human Liver, Cellular Data: Hepatocytes, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
Sample Type: MCF7 cells, Primary Antibody Dilution: 1:200, Secondary Antibody: Anti-rabbit-FITC, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: DAPI: Blue hnRNPL: Green, Gene Name: HNRPL.
WB Suggested Anti-HNRPL Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate. HNRNPL is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.
ELISA, IHC, WB | |
Canine, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating