HNRNPH3 antibody

• Catalog Number: orb324892
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HNRNPH3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HNRPH3
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 38 kDa
• Target: HNRNPH3
• UniProt ID: P31942
• Protein Sequence: Synthetic peptide located within the following region: DYQGRSTGEAFVQFASKEIAENALGKHKERIGHRYIEIFRSSRSEIKGFY
• NCBI: NP_036339
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti 2H9 antibody, anti HNRPH3 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/mL. Two closely sized isoforms are observed in some samples, and a smaller isoform is observed in 293T cells.

Rabbit Anti-HNRNPH3 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

Rabbit Anti-HNRPH3 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-HNRPH3 Antibody Titration: 1.0 ug/mL, ELISA Titer: 1:62500, Positive Control: Raji cell lysate, HNRNPH3 is strongly supported by BioGPS gene expression data to be expressed in Human Raji cells.