HNRNPH1 antibody

• Catalog Number: orb326259
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HNRNPH1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ICC, IF, IP, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HNRPH1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 49 kDa
• Target: HNRNPH1
• UniProt ID: P31943
• Protein Sequence: Synthetic peptide located within the following region: FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG
• NCBI: NP_005511
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti DKFZp686A15170 antibody, anti HNRPH antibody,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human Jurkat tissue using HNRNPH1 antibody

Western blot analysis of human 721_B tissue using HNRNPH1 antibody

Western blot analysis of HepG2 cell lysate tissue using HNRNPH1 antibody

Immunohistochemical staining of human Testis tissue using HNRNPH1 antibody

Immunohistochemical staining of MCF-7 cell tissue using HNRNPH1 antibody

Immunohistochemical staining of K562 cell tissue using HNRNPH1 antibody

Western blot analysis of HeLa S3, MCF7, K562 tissue using HNRNPH1 antibody

Western blot analysis of human MCF7 tissue using HNRNPH1 antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.

Amount and Sample Type: Lane 1: 5% Input, Lane 2: 5% Sup, Lane 3: Normal IgG, Lane 4: hn-RNPH1 ppt. k562 sample, IP Antibody: HNRPH1, Amount of IP Antibody, Primary Antibody: HNRPH1, Primary Antibody Dilution: 1:4000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: HNRPH1.

Host: Rabbit, Target Name: HNRNPH1, Sample Type: 721_B, Antibody Dilution: 1.0 ug/mL, HNRNPH1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Host: Rabbit, Target Name: HNRNPH1, Sample Type: Jurkat, Antibody Dilution: 1.0 ug/mL, HNRNPH1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.

Host: Rabbit, Target Name: HNRNPH1, Sample Type: MCF7, Antibody Dilution: 1.0 ug/mL, HNRNPH1 is strongly supported by BioGPS gene expression data to be expressed in MCF7.

IHC Information: Paraffin embedded testis tissue, tested with an antibody Dilution of 5 ug/mL.

Lanes: Lane 1: 20 ug HeLa S3 lysate Lane 2: 20 ug MCF7 lysate Lane 3: 20 ug K562 lysate, Primary Antibody Dilution: 1:4000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: HNRPH1.

Sample Type: MCF7 cells, Primary Antibody Dilution: 1:200, Secondary Antibody: Anti-rabbit-FITC, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: DAPI: Blue HNRNPH1: Green, Gene Name: HNRPH1.

WB Suggested Anti-HNRPH1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate, HNRNPH1 is supported by BioGPS gene expression data to be expressed in HepG2.