You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb588406 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to HNRNPAB |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human HNRNPAB |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 36 kDa |
Target | HNRNPAB |
UniProt ID | Q99729 |
Protein Sequence | Synthetic peptide located within the following region: GSKCEIKVAQPKEVYQQQQYGSGGRGNRNRGNRGSGGGGGGGGQSQSWNQ |
NCBI | NP_112556 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | ABBP1, HNRPAB Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: HNRNPAB, Sample Tissue: Human Ovary Tumor lysates, Antibody Dilution: 1 ug/ml.
ELISA, IHC, WB | |
Canine, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating