HNRNPA3 antibody

• Catalog Number: orb324945
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HNRNPA3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HNRPA3
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 42kDa
• Target: HNRNPA3
• UniProt ID: P51991
• Protein Sequence: Synthetic peptide located within the following region: MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDS
• NCBI: NP_919223
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti FBRNP antibody, anti HNRPA3 antibody, anti D1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human Daudi tissue using HNRNPA3 antibody

Western blot analysis of Jurkat cell lysate tissue using HNRNPA3 antibody

Immunohistochemical staining of human Liver tissue using HNRNPA3 antibody

Immunohistochemical staining of human Lung tissue using HNRNPA3 antibody

Western blot analysis of Jurkat tissue using HNRNPA3 antibody

Western blot analysis of human 721_B tissue using HNRNPA3 antibody

Host: Rabbit, Target Name: HNRPA3, Sample Tissue: Human Jurkat, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: HNRPA3, Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 0.625 ug/mL, Peptide Concentration: 1.0 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

Host: Rabbit, Target: HNRNPA3, Positive control (+): HeLa Cell Lysate (HL), Negative control (-): Human Fetal Heart (HE), Antibody concentration: 3 ug/mL.

Rabbit Anti-HNRPA3 Antibody, Paraffin Embedded Tissue: Human Liver, Cellular Data: Hepatocytes, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

Rabbit Anti-HNRPA3 Antibody, Paraffin Embedded Tissue: Human Lung, Cellular Data: Alveolar cells, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-HNRPA3 antibody Titration: 1 ug/mL, Sample Type: Human 721_B.

WB Suggested Anti-HNRPA3 antibody Titration: 1 ug/mL, Sample Type: Human Daudi.

WB Suggested Anti-HNRPA3 Antibody Titration: 1.25 ug/mL, Positive Control: Jurkat cell lysate, HNRNPA3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.