You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324888 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to HNRNPA0 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | ICC, IF, IP, WB |
Predicted Reactivity | Bovine, Canine, Human, Porcine |
Reactivity | Canine, Human, Porcine |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human HNRPA0 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 34kDa |
Target | HNRNPA0 |
UniProt ID | Q13151 |
Protein Sequence | Synthetic peptide located within the following region: KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG |
NCBI | NP_006796 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti HNRPA0 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Immunohistochemical staining of human Heart tissue using HNRNPA0 antibody
Immunohistochemical staining of human Liver tissue using HNRNPA0 antibody
Immunohistochemical staining of human Heart tissue using HNRNPA0 antibody
Immunohistochemical staining of MCF-7 cell tissue using HNRNPA0 antibody
Immunohistochemical staining of K562 cell tissue using HNRNPA0 antibody
Western blot analysis of HeLa S3, MCF7, K562 tissue using HNRNPA0 antibody
Western blot analysis of Jurkat cell lysate tissue using HNRNPA0 antibody
Amount and Sample Type: Lane 1: 5% Input, Lane 2: 5% Sup, Lane 3: Normal IgG, Lane 4: hn-RNPA0 ppt. k562 sample, IP Antibody: HNRPA0, Amount of IP Antibody, Primary Antibody: HNRPA0, Primary Antibody Dilution: 1:4000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: HNRPA0.
Lane 1: 20 ug HeLa S3 lysate Lane 2: 20 ug MCF7 lysate Lane 3: 20 ug K562 lysate, Primary Antibody Dilution: 1:4000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: HNRPA0.
Rabbit Anti-HNRNPA0 Antibody, Paraffin Embedded Tissue: Human cardiac cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.
Rabbit Anti-HNRPA0 Antibody, Paraffin Embedded Tissue: Human Heart, Cellular Data: Myocardial cells, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.
Rabbit Anti-HNRPA0 Antibody, Paraffin Embedded Tissue: Human Liver, Cellular Data: Hepatocytes, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.
Sample Type: MCF7 cells, Primary Antibody Dilution: 1:200, Secondary Antibody: Anti-rabbit-FITC, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: DAPI: Blue hn-RNPA0: Green, Gene Name: HNRPA0.
WB Suggested Anti-HNRPA0 Antibody Titration: 0.625 ug/mL, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.
IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating