Cart summary

You have no items in your shopping cart.

    HNRNPA0 antibody

    Catalog Number: orb324888

    DispatchUsually dispatched within 1 - 2 weeks
    $ 537.00
    Catalog Numberorb324888
    CategoryAntibodies
    DescriptionRabbit polyclonal antibody to HNRNPA0
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsICC, IF, IP, WB
    Predicted ReactivityBovine, Canine, Human, Porcine
    ReactivityCanine, Human, Porcine
    ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human HNRPA0
    Concentration1.0 mg/ml
    Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    ConjugationUnconjugated
    MW34kDa
    TargetHNRNPA0
    UniProt IDQ13151
    Protein SequenceSynthetic peptide located within the following region: KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG
    NCBINP_006796
    StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
    Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Alternative namesanti HNRPA0 antibody
    Read more...
    NoteFor research use only
    Expiration Date12 months from date of receipt.
    HNRNPA0 antibody

    Immunohistochemical staining of human Heart tissue using HNRNPA0 antibody

    HNRNPA0 antibody

    Immunohistochemical staining of human Liver tissue using HNRNPA0 antibody

    HNRNPA0 antibody

    Immunohistochemical staining of human Heart tissue using HNRNPA0 antibody

    HNRNPA0 antibody

    Immunohistochemical staining of MCF-7 cell tissue using HNRNPA0 antibody

    HNRNPA0 antibody

    Immunohistochemical staining of K562 cell tissue using HNRNPA0 antibody

    HNRNPA0 antibody

    Western blot analysis of HeLa S3, MCF7, K562 tissue using HNRNPA0 antibody

    HNRNPA0 antibody

    Western blot analysis of Jurkat cell lysate tissue using HNRNPA0 antibody

    HNRNPA0 antibody

    Amount and Sample Type: Lane 1: 5% Input, Lane 2: 5% Sup, Lane 3: Normal IgG, Lane 4: hn-RNPA0 ppt. k562 sample, IP Antibody: HNRPA0, Amount of IP Antibody, Primary Antibody: HNRPA0, Primary Antibody Dilution: 1:4000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: HNRPA0.

    HNRNPA0 antibody

    Lane 1: 20 ug HeLa S3 lysate Lane 2: 20 ug MCF7 lysate Lane 3: 20 ug K562 lysate, Primary Antibody Dilution: 1:4000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: HNRPA0.

    HNRNPA0 antibody

    Rabbit Anti-HNRNPA0 Antibody, Paraffin Embedded Tissue: Human cardiac cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

    HNRNPA0 antibody

    Rabbit Anti-HNRPA0 Antibody, Paraffin Embedded Tissue: Human Heart, Cellular Data: Myocardial cells, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

    HNRNPA0 antibody

    Rabbit Anti-HNRPA0 Antibody, Paraffin Embedded Tissue: Human Liver, Cellular Data: Hepatocytes, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

    HNRNPA0 antibody

    Sample Type: MCF7 cells, Primary Antibody Dilution: 1:200, Secondary Antibody: Anti-rabbit-FITC, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: DAPI: Blue hn-RNPA0: Green, Gene Name: HNRPA0.

    HNRNPA0 antibody

    WB Suggested Anti-HNRPA0 Antibody Titration: 0.625 ug/mL, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.

    • HNRNPA0 Antibody [orb1242070]

      ELISA,  IHC,  WB

      Human

      Rabbit

      Polyclonal

      Unconjugated

      100 μl
    • HNRNPA0 Antibody [orb1257220]

      IF,  IHC,  IP,  WB

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      100 μl
    • HNRNPA0 antibody [orb352901]

      ELISA,  WB

      Human, Mouse

      Rabbit

      Polyclonal

      Unconjugated

      100 μl, 50 μl
    • HNRNPA0 antibody [orb373328]

      IP,  WB

      Human, Mouse, Rat

      Polyclonal

      Unconjugated

      200 μl, 100 μl, 50 μl
    • HNRNPA0 antibody [orb378105]

      IP,  WB

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      200 μl, 100 μl, 50 μl
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars