Cart summary

You have no items in your shopping cart.

    hnRNP A2B1/HNRNPA2B1 Antibody

    Catalog Number: orb412956

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb412956
    CategoryAntibodies
    DescriptionhnRNP A2B1/HNRNPA2B1 Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsFC, ICC, IF, IHC, WB
    ReactivityHuman, Mouse, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence of human hnRNP A2B1 (KTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKL).
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW37 kDa
    UniProt IDP22626
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesHeterogeneous nuclear ribonucleoproteins A2/B1; hn
    Read more...
    NoteFor research use only
    Application notesAdd 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    hnRNP A2B1/HNRNPA2B1 Antibody

    Flow Cytometry analysis of A431 cells using anti-hnRNP A2B1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

    hnRNP A2B1/HNRNPA2B1 Antibody

    WB analysis of hnRNP A2B1 using anti-hnRNP A2B1 antibody.Lane 1:human HeLa cell;2:human placenta tissue;3:human MDA-MB-453 cell;4:human SW620 cell;5:human HepG2 cell;6:human 22RV1 cell;7:human A431 cell;8:human A375 cell.

    hnRNP A2B1/HNRNPA2B1 Antibody

    IF analysis of hnRNP A2B1 using anti-hnRNP A2B1 antibody. hnRNP A2B1 was detected in immunocytochemical section of U20S cells.

    hnRNP A2B1/HNRNPA2B1 Antibody

    IHC analysis of hnRNP A2B1 using anti-hnRNP A2B1 antibody. hnRNP A2B1 was detected in paraffin-embedded section of human intestinal cancer tissue.

    hnRNP A2B1/HNRNPA2B1 Antibody

    IHC analysis of hnRNP A2B1 using anti-hnRNP A2B1 antibody. hnRNP A2B1 was detected in paraffin-embedded section of rat brain tissue.

    hnRNP A2B1/HNRNPA2B1 Antibody

    IHC analysis of hnRNP A2B1 using anti-hnRNP A2B1 antibody. hnRNP A2B1 was detected in paraffin-embedded section of mouse brain tissue.

    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars