Cart summary

You have no items in your shopping cart.

    HnRNP A1/HNRNPA1 Antibody

    Catalog Number: orb389413

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb389413
    CategoryAntibodies
    DescriptionHnRNP A1/HNRNPA1 Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsFC, ICC, IF, IHC, WB
    ReactivityHuman, Mouse, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence at the N-terminus of human HnRNP A1 (8-42aa KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTD), identical to the related mouse and rat sequences.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Dilution rangeWestern blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Immunofluorescence, 2μg/ml, Human Immunocytochemistry/Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW38747 MW
    UniProt IDP09651
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesHeterogeneous nuclear ribonucleoprotein A1;hnRNP A
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    HnRNP A1/HNRNPA1 Antibody

    Flow Cytometry analysis of K562 cells using anti-HnRNP A1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

    HnRNP A1/HNRNPA1 Antibody

    WB analysis of HnRNP A1 using anti-HnRNP A1 antibody.Lane 1:human HepG2 cell; 2:human Daudi cell; 3:human MOLT-4 cell; 4:human HL-60 cell.

    HnRNP A1/HNRNPA1 Antibody

    IF analysis of HnRNP A1 using anti-HnRNP A1 antibody. HnRNP A1 was detected in paraffin-embedded section of human rectal cancer tissue.

    HnRNP A1/HNRNPA1 Antibody

    IF analysis of HnRNP A1 using anti-HnRNP A1 antibody. HnRNP A1 was detected in a paraffin-embedded section of mouse brain tissue.

    HnRNP A1/HNRNPA1 Antibody

    IF analysis of HnRNP A1 using anti-HnRNP A1 antibody. HnRNP A1 was detected in a paraffin-embedded section of rat brain tissue.

    HnRNP A1/HNRNPA1 Antibody

    IF analysis of HnRNP A1 using anti-HnRNP A1 antibody. HnRNP A1 was detected in immunocytochemical section of U20S cells.

    HnRNP A1/HNRNPA1 Antibody

    IF analysis of HnRNP A1 using anti-HnRNP A1 antibody. HnRNP A1 was detected in immunocytochemical section of A431 cells.

    HnRNP A1/HNRNPA1 Antibody

    IHC analysis of HnRNP A1 using anti-HnRNP A1 antibody. HnRNP A1 was detected in paraffin-embedded section of mouse intestine tissues.

    HnRNP A1/HNRNPA1 Antibody

    IHC analysis of HnRNP A1 using anti-HnRNP A1 antibody. HnRNP A1 was detected in paraffin-embedded section of mouse kidney tissues.

    HnRNP A1/HNRNPA1 Antibody

    IHC analysis of HnRNP A1 using anti-HnRNP A1 antibody. HnRNP A1 was detected in paraffin-embedded section of rat kidney tissues.

    HnRNP A1/HNRNPA1 Antibody

    IHC analysis of HnRNP A1 using anti-HnRNP A1 antibody. HnRNP A1 was detected in paraffin-embedded section of human intestinal cancer tissues.

    HnRNP A1/HNRNPA1 Antibody

    IHC analysis of HnRNP A1 using anti-HnRNP A1 antibody. HnRNP A1 was detected in paraffin-embedded section of human placenta tissues.

    • Methyl-hnRNP A1-H173 antibody [orb1150477]

      WB

      Human

      Rabbit

      Polyclonal

      Unconjugated

      50 μl, 100 μl, 200 μl
    • hnRNP A1 Rabbit Antibody [orb1676111]

      WB

      Human

      Polyclonal

      Unconjugated

      200 μl, 100 μl, 50 μl
    • hnRNP A1 polyclonal antibody [orb1718686]

      WB

      Human

      Rabbit

      Polyclonal

      Unconjugated

      100 μg, 50 μg
    • hnRNP A1 antibody (Biotin) [orb455262]

      ELISA,  ICC,  IHC-Fr,  IHC-P

      Bovine, Equine, Human, Monkey, Rabbit, Sheep

      Mouse, Rat

      Rabbit

      Polyclonal

      Biotin

      100 μl
    • HNRNPA1 antibody [orb1292559]

      ELISA,  IF,  IHC,  WB

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      100 μg
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars