HNF4A antibody

• Catalog Number: orb329675
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HNF4A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Sheep, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HNF4A
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 50kDa
• Target: HNF4A
• UniProt ID: P41235
• Protein Sequence: Synthetic peptide located within the following region: RGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEV
• NCBI: NP_787110
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti FLJ39654 antibody, anti HNF4 antibody, anti H
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of OVCAR-3 cell lysate tissue using HNF4A antibody

Immunohistochemical staining of human Small Intestine tissue using HNF4A antibody

Host: Rabbit, Target: HNF4A, Positive control (+): Human Kidney (KI), Negative control (-): Mouse Brain (M-BR), Antibody concentration: 1 ug/mL.

Human Small Intestine

WB Suggested Anti-HNF4A Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: OVCAR-3 cell lysate, HNF4A is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells.